Skip to main content

Vitamin D

Vitamin

Also known as: cholecalciferol, D3, ergocalciferol, D2, calciferol

A
Grade A
πŸ’Š 400-4,000 IU daily for maintenance; 1,000-4,000 IU common in supplements🎯 12 primary usesπŸ”— 3 synergiesℹ️ Check contraindications

Overview

Vitamin D is a fat-soluble hormone and micronutrient essential for calcium absorption, bone health, immune function, and cellular regulation. Most people have insufficient levels and may benefit from supplementation, particularly those with limited sun exposure.

Primary Uses
Bone healthImmune supportMood regulationMuscle functionVitamin D supplementationVegan vitamin D sourceBone supportImmune functionTestosteroneReproductive hormonesImplantationMale and female fertility

Dosage

Typical range
400-4,000 IU daily for maintenance; 1,000-4,000 IU common in supplements
Timing
Best absorbed with fat-containing meal; timing otherwise flexible
With food
Recommend with dietary fat for optimal absorption
Dose Tiers
RDA / DV
600-800 IU
Low
400-800 IU
Moderate
1,000-2,000 IU
Optimal
2,000-5,000 IU
Therapeutic
5,000-10,000 IU
Upper Limit
10,000 IU
Duration

Safe for long-term use; fat-soluble so accumulates in bodyβ€”monitor levels if taking high doses

Special Populations

Older adults (50+) may need higher amounts (600-800 IU minimum); dark-skinned individuals in northern climates need more; pregnant/nursing women should discuss dosing with healthcare provider

Mechanism of Action

  • β€’ Acts as a hormone regulating calcium and phosphate absorption
  • β€’ Activates vitamin D receptors throughout the body
  • β€’ Modulates immune cell differentiation and function
  • β€’ Supports muscle protein synthesis
  • β€’ Influences neurotransmitter and hormone production

Evidence Quality

Evidence Grade A

Strong RCT evidence supports vitamin D for bone health, immune function, and reducing deficiency. Extensive observational data supports broader health benefits. Recommended by major health organizations.

Safety & Contraindications

Contraindications
  • β€’ Hypercalcemia or conditions causing elevated calcium
  • β€’ Sarcoidosis and certain granulomatous diseases (vitamin D increases calcium absorption)
  • β€’ Concurrent high-dose calcium supplementation (risk of toxicity)
Common Side Effects
  • β€’ Minimal at recommended doses
  • β€’ Excessive intake (>10,000 IU chronically) may cause hypercalcemia, nausea, weakness

Interactions

πŸ’Š Medications
  • β€’ Glucocorticoids (reduced vitamin D effectiveness)
  • β€’ Anticonvulsants like phenytoin (increased vitamin D metabolism)
  • β€’ Orlistat (reduced fat-soluble vitamin absorption)
πŸ§ͺ Supplements
  • β€’ Calcium (synergistic for bone health)
  • β€’ Magnesium (needed for vitamin D metabolism)
  • β€’ K2 (complementary for bone and cardiovascular health)

Stacking & Synergies

Pairs Well With
Vitamin K2MagnesiumOmega-3s
Avoid Combining With
High calcium without K2
Best Goal Synergies
Bone healthImmune support

Buying Guide

Standardization Markers
Third-party tested for potency and purityD3 (cholecalciferol) preferred over D2 (ergocalciferol) for efficacyVerified for listed IU content
Practical Notes
  • β€’ Test levels before/after
  • β€’ Optimal: 40-60 ng/mL
  • β€’ Take with largest meal
  • β€’ D3 is 87% more effective
  • β€’ Consider lichen-derived D3 as vegan alternative
  • β€’ Test levels to optimize
  • β€’ Always pair with K2
  • β€’ Test blood levels
  • β€’ Target 40-60 ng/mL for fertility
  • β€’ D3 preferred over D2
  • β€’ Often deficient in PCOS
  • β€’ Test and optimize levels
  • β€’ D3 form preferred
  • β€’ Must protect eyes
  • β€’ Follow device timing exactly
  • β€’ Produces natural D plus other compounds
Tags
fat-solublehormone precursorimmunebone healthveganvitaminbonemusclefertilityhormonepregnancypcosinsulinvitamin-dlight-therapyuvbnaturalimmune supportfat-soluble vitaminwell-researcheddeficiency common

Frequently Asked About Vitamin D

How much Vitamin D should I take?
The typical effective range is 2,000-5,000 IU. Individual needs vary based on age, body weight, diet, and goals β€” start at the lower end and adjust based on response. Always consult a healthcare provider before starting a new supplement.
When is the best time to take Vitamin D?
Best absorbed with fat-containing meal; timing otherwise flexible. Consistency matters more than perfect timing β€” pick a daily anchor (e.g. with breakfast or before bed) and stick with it.
Should I take Vitamin D with food?
Recommend with dietary fat for optimal absorption.
Does Vitamin D interact with medications?
Yes β€” known interactions include Glucocorticoids (reduced vitamin D effectiveness), Anticonvulsants like phenytoin (increased vitamin D metabolism), and Orlistat (reduced fat-soluble vitamin absorption). If you take any prescription medication, talk to your doctor or pharmacist before starting Vitamin D.
What does Vitamin D pair well with?
Vitamin D stacks well with Vitamin K2, Magnesium, and Omega-3s β€” these combinations either improve absorption or work synergistically toward common goals.
Who should not take Vitamin D?
Vitamin D should be avoided or used with caution by people with Hypercalcemia or conditions causing elevated calcium, Sarcoidosis and certain granulomatous diseases (vitamin D increases calcium absorption), and Concurrent high-dose calcium supplementation (risk of toxicity). Pregnant or breastfeeding women should consult a healthcare provider before use.
What are the side effects of Vitamin D?
Most people tolerate Vitamin D well. The most commonly reported side effects are Minimal at recommended doses and Excessive intake (>10,000 IU chronically) may cause hypercalcemia, nausea, weakness. Side effects are usually dose-dependent β€” lowering the dose often resolves them.

Top Products with Vitamin D

Related Guides

Educational content based on published research and our scoring methodology. Not medical advice β€” consult a qualified healthcare provider before starting, stopping, or changing supplements, especially if you take medications, are pregnant, or have a medical condition.